Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (11 species) not a true protein |
Species Carrot (Daucus carota) [TaxId:4039] [195560] (2 PDB entries) |
Domain d3vlaa_: 3vla A: [195561] automated match to d3hd8c_ complexed with nag |
PDB Entry: 3vla (more details), 0.95 Å
SCOPe Domain Sequences for d3vlaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vlaa_ b.50.1.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]} epsfrpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyr pvrcrtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvest dgsssgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfam clsgstssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfig vksikinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarni trvasvapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclg vvdggsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnfts
Timeline for d3vlaa_: