Lineage for d3vlaa_ (3vla A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2061036Family b.50.1.0: automated matches [191552] (1 protein)
    not a true family
  6. 2061037Protein automated matches [190954] (10 species)
    not a true protein
  7. 2061058Species Carrot (Daucus carota) [TaxId:4039] [195560] (2 PDB entries)
  8. 2061059Domain d3vlaa_: 3vla A: [195561]
    automated match to d3hd8c_
    complexed with nag

Details for d3vlaa_

PDB Entry: 3vla (more details), 0.95 Å

PDB Description: Crystal structure of edgp
PDB Compounds: (A:) edgp

SCOPe Domain Sequences for d3vlaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlaa_ b.50.1.0 (A:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
epsfrpsalvvpvkkdastlqyvttinqrtplvsenlvvdlggrflwvdcdqnyvsstyr
pvrcrtsqcslsgsiacgdcfngprpgcnnntcgvfpenpvintatggevaedvvsvest
dgsssgrvvtvprfifscaptsllqnlasgvvgmaglgrtrialpsqfasafsfkrkfam
clsgstssnsviifgndpytflpniivsdktltytplltnpvstsatstqgepsveyfig
vksikinskivalntsllsissaglggtkistinpytvletsiykavteafikesaarni
trvasvapfgacfstdnilstrlgpsvpsidlvlqsesvvwtitgsnsmvyindnvvclg
vvdggsnlrtsivigghqlednlvqfdlatsrvgfsgtllgsrttcanfnfts

SCOPe Domain Coordinates for d3vlaa_:

Click to download the PDB-style file with coordinates for d3vlaa_.
(The format of our PDB-style files is described here.)

Timeline for d3vlaa_: