Lineage for d3vl8a_ (3vl8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780849Species Fungus (Aspergillus aculeatus) [TaxId:5053] [195557] (6 PDB entries)
  8. 2780852Domain d3vl8a_: 3vl8 A: [195558]
    automated match to d1oa2a_
    complexed with so4

Details for d3vl8a_

PDB Entry: 3vl8 (more details), 1.9 Å

PDB Description: Crystal structure of XEG
PDB Compounds: (A:) Xyloglucan-specific endo-beta-1,4-glucanase A

SCOPe Domain Sequences for d3vl8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vl8a_ b.29.1.0 (A:) automated matches {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
qrrsdfcgqwdtatagdftlyndlwgesagtgsqctgvdsysgdtiawhtswswsggsss
vksyvnaaltftptqlncissipttwkwsysgssivadvaydtflaetasgsskyeimvw
laalggagpisstgstiatptiagvnwklysgpngdttvysfvadsttesfsgdlndfft
ylvdnegvsdelylttleagtepftgsnakltvseysisie

SCOPe Domain Coordinates for d3vl8a_:

Click to download the PDB-style file with coordinates for d3vl8a_.
(The format of our PDB-style files is described here.)

Timeline for d3vl8a_: