Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [188287] (7 PDB entries) |
Domain d2yf5b_: 2yf5 B: [195556] automated match to d3bevb_ complexed with edo |
PDB Entry: 2yf5 (more details), 2.82 Å
SCOPe Domain Sequences for d2yf5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yf5b_ b.1.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddwtf qrlvhadftpssgstyackvehetlkepqvykwdpef
Timeline for d2yf5b_: