Lineage for d2notb_ (2not B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346220Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry)
    neurotoxic phospholipase a2
  8. 2346222Domain d2notb_: 2not B: [19555]

Details for d2notb_

PDB Entry: 2not (more details), 3 Å

PDB Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus
PDB Compounds: (B:) phospholipase a2

SCOPe Domain Sequences for d2notb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2notb_ a.133.1.2 (B:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId: 8663]}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

SCOPe Domain Coordinates for d2notb_:

Click to download the PDB-style file with coordinates for d2notb_.
(The format of our PDB-style files is described here.)

Timeline for d2notb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nota_