![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein Snake phospholipase A2 [48624] (38 species) |
![]() | Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry) neurotoxic phospholipase a2 |
![]() | Domain d2notb_: 2not B: [19555] |
PDB Entry: 2not (more details), 3 Å
SCOPe Domain Sequences for d2notb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2notb_ a.133.1.2 (B:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId: 8663]} nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
Timeline for d2notb_: