![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
![]() | Protein automated matches [191081] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189020] (3 PDB entries) |
![]() | Domain d4dk9a_: 4dk9 A: [195549] automated match to d1ngna_ protein/DNA complex; complexed with k |
PDB Entry: 4dk9 (more details), 2.76 Å
SCOPe Domain Sequences for d4dk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dk9a_ a.96.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wtpprspfnlvqetlfhdpwklliatiflnrtsgkmaipvlwkflekypsaevartadwr dvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqvh pedhklnkyhdwlwenhekl
Timeline for d4dk9a_: