Lineage for d4dk9a_ (4dk9 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329190Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2329191Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2329199Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)
  6. 2329227Protein automated matches [191081] (1 species)
    not a true protein
  7. 2329228Species Human (Homo sapiens) [TaxId:9606] [189020] (3 PDB entries)
  8. 2329230Domain d4dk9a_: 4dk9 A: [195549]
    automated match to d1ngna_
    protein/DNA complex; complexed with k

Details for d4dk9a_

PDB Entry: 4dk9 (more details), 2.76 Å

PDB Description: Crystal Structure of MBD4 Catalytic Domain Bound to Abasic DNA
PDB Compounds: (A:) Methyl-CpG-binding domain protein 4

SCOPe Domain Sequences for d4dk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dk9a_ a.96.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtpprspfnlvqetlfhdpwklliatiflnrtsgkmaipvlwkflekypsaevartadwr
dvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqvh
pedhklnkyhdwlwenhekl

SCOPe Domain Coordinates for d4dk9a_:

Click to download the PDB-style file with coordinates for d4dk9a_.
(The format of our PDB-style files is described here.)

Timeline for d4dk9a_: