Lineage for d4e1na_ (4e1n A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2139404Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2139537Protein automated matches [190209] (5 species)
    not a true protein
  7. 2139659Species Human immunodeficiency virus type 1 [TaxId:11698] [195546] (3 PDB entries)
  8. 2139662Domain d4e1na_: 4e1n A: [195547]
    automated match to d1bl3c_
    complexed with tqx

Details for d4e1na_

PDB Entry: 4e1n (more details), 2 Å

PDB Description: crystal structure of hiv-1 integrase with a non-catayltic site inhibitor
PDB Compounds: (A:) hiv-1 integrase

SCOPe Domain Sequences for d4e1na_:

Sequence, based on SEQRES records: (download)

>d4e1na_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsatvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records): (download)

>d4e1na_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvht
dngsnftsatvkaacwwagikqefgipnpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnkkrkysagerivdiiatd

SCOPe Domain Coordinates for d4e1na_:

Click to download the PDB-style file with coordinates for d4e1na_.
(The format of our PDB-style files is described here.)

Timeline for d4e1na_: