SCOPe 2.03: Domain d4ef2b_: 4ef2 B:

Lineage for d4ef2b_ (4ef2 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [195543] (3 PDB entries)

8. Domain d4ef2b_: 4ef2 B: [195544]
   automated match to d1xs5a_
   complexed with cl, mse, pe8, peg, pge

Details for d4ef2b_

PDB Entry: 4ef2, 2.1 Å

PDB Description: crystal structure of a pheromone cob1 precursor/lipoprotein, yaec family (ef2496) from enterococcus faecalis v583 at 2.10 a resolution

PDB Compounds: (B:) Pheromone cOB1/lipoprotein, YaeC family

SCOPe Domain Sequences for d4ef2b_:

Sequence; same for both SEQRES and ATOM records:

>d4ef2b_ c.94.1.0 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
svlkvgaspvphaeilehvkpllekegvklevttytdyvlpnkalesgdidanyfqhvpf
fneavkendydfvnagaihlepvglyskkykslqeipdgstiyvsssvsdwprvltiled
aglitlkegvdrttatfddidkntkklkfnhesdpaimttlydneegaavlinsnfavdq
glnpkkdaialekesspyaniiavrkedennenvkklvkvlrskevqdwitkkwngaivp
v

Timeline for d4ef2b_:

• d4ef2b_ first appeared in SCOPe 2.02
  
• d4ef2b_ appears in SCOPe 2.04
  
• d4ef2b_ appears in the current release, SCOPe 2.08