Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Snake phospholipase A2 [48624] (38 species) |
Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry) neurotoxic phospholipase a2 |
Domain d2nota_: 2not A: [19554] |
PDB Entry: 2not (more details), 3 Å
SCOPe Domain Sequences for d2nota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nota_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId: 8663]} nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
Timeline for d2nota_: