| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
| Protein Snake phospholipase A2 [48624] (35 species) |
| Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry) neurotoxic phospholipase a2 |
| Domain d2nota_: 2not A: [19554] |
PDB Entry: 2not (more details), 3 Å
SCOP Domain Sequences for d2nota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nota_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq
Timeline for d2nota_: