Lineage for d2nota_ (2not A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449218Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry)
    neurotoxic phospholipase a2
  8. 449219Domain d2nota_: 2not A: [19554]

Details for d2nota_

PDB Entry: 2not (more details), 3 Å

PDB Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus

SCOP Domain Sequences for d2nota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nota_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

SCOP Domain Coordinates for d2nota_:

Click to download the PDB-style file with coordinates for d2nota_.
(The format of our PDB-style files is described here.)

Timeline for d2nota_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2notb_