SCOP 1.55: Domain d2nota_: 2not A:

Lineage for d2nota_ (2not A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)

6. Protein Snake phospholipase A2 [48624] (12 species)

7. Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry)

8. Domain d2nota_: 2not A: [19554]

Details for d2nota_

PDB Entry: 2not, 3 Å

PDB Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus

SCOP Domain Sequences for d2nota_:

Sequence; same for both SEQRES and ATOM records:

>d2nota_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

Timeline for d2nota_:

• d2nota_ appears in SCOP 1.57
  
• d2nota_ appears in the current release, SCOPe 2.08