SCOPe 2.08: Domain d2nota_: 2not A:

Lineage for d2nota_ (2not A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId:8663] [48632] (1 PDB entry)
   neurotoxic phospholipase a2

8. Domain d2nota_: 2not A: [19554]

Details for d2nota_

PDB Entry: 2not, 3 Å

PDB Description: notechis ii-5, neurotoxic phospholipase a2 from notechis scutatus scutatus

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d2nota_:

Sequence; same for both SEQRES and ATOM records:

>d2nota_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notechis II-5 [TaxId: 8663]}
nlvqfsyliqcanhgrrptrhymdygcycgwggsgtpvdeldrcckihddcysdaekkgc
spkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

Timeline for d2nota_:

• d2nota_ first appeared (with stable ids) in SCOP 1.55
  
• d2nota_ appears in SCOPe 2.07