SCOPe 2.08: Domain d3s0ma_: 3s0m A:

Lineage for d3s0ma_ (3s0m A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Oxalate decarboxylase OxdC (YvrK) [75033] (1 species)
   duplication: consists of two germin-like metal-ion binding domains

7. Species Bacillus subtilis [TaxId:1423] [75034] (4 PDB entries)

8. Domain d3s0ma_: 3s0m A: [195530]
   automated match to d1uw8a_
   complexed with co3, edo, mn, peg
   multiple common domains: applies to families that are inconsistently divided into domains
   has additional insertions and/or extensions that are not grouped together

Details for d3s0ma_

PDB Entry: 3s0m, 2.31 Å

PDB Description: a structural element that modulates proton-coupled electron transfer in oxalate decarboxylase

PDB Compounds: (A:) oxalate decarboxylase oxdc

SCOPe Domain Sequences for d3s0ma_:

Sequence; same for both SEQRES and ATOM records:

>d3s0ma_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfsensvfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

Timeline for d3s0ma_:

• d3s0ma_ first appeared in SCOPe 2.02
  
• d3s0ma_ appears in SCOPe 2.07