SCOPe 2.06: Domain d1ae7a_: 1ae7 A:

Lineage for d1ae7a_ (1ae7 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId:8663] [48631] (2 PDB entries)
   presynaptic neurotoxic phospholipase A2

8. Domain d1ae7a_: 1ae7 A: [19553]
   complexed with so4

Details for d1ae7a_

PDB Entry: 1ae7, 2 Å

PDB Description: notexin, a presynaptic neurotoxic phospholipase a2

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1ae7a_:

Sequence; same for both SEQRES and ATOM records:

>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]}
nlvqfsyliqcanhgkrptwhymdygcycgaggsgtpvdeldrcckihddcydeagkkgc
fpkmsaydyycgengpycrnikkkclrfvcdcdveaafcfakapynnanwnidtkkrcq

Timeline for d1ae7a_:

• d1ae7a_ first appeared (with stable ids) in SCOP 1.55, called d1ae7__
  
• d1ae7a_ appears in SCOPe 2.05
  
• d1ae7a_ appears in SCOPe 2.07
  
• d1ae7a_ appears in the current release, SCOPe 2.08