SCOPe 2.08: Domain d3toea_: 3toe A:

Lineage for d3toea_ (3toe A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (3 families)

5. Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)

6. Protein automated matches [190221] (4 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [195510] (1 PDB entry)

8. Domain d3toea_: 3toe A: [195512]
   automated match to d1nfja_

Details for d3toea_

PDB Entry: 3toe, 2.2 Å

PDB Description: structure of mth10b

PDB Compounds: (A:) DNA/RNA-binding protein Alba

SCOPe Domain Sequences for d3toea_:

Sequence; same for both SEQRES and ATOM records:

>d3toea_ d.68.6.1 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
nvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiqieni
dicteeiignegtatnvsaieiqlrk

Timeline for d3toea_:

• d3toea_ first appeared in SCOPe 2.02
  
• d3toea_ appears in SCOPe 2.07