Lineage for d3toea_ (3toe A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957431Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2957450Protein automated matches [190221] (4 species)
    not a true protein
  7. 2957451Species Methanothermobacter thermautotrophicus [TaxId:187420] [195510] (1 PDB entry)
  8. 2957452Domain d3toea_: 3toe A: [195512]
    automated match to d1nfja_

Details for d3toea_

PDB Entry: 3toe (more details), 2.2 Å

PDB Description: structure of mth10b
PDB Compounds: (A:) DNA/RNA-binding protein Alba

SCOPe Domain Sequences for d3toea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toea_ d.68.6.1 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
nvvyignkpvmnyvlavvtqmnggtsevilkargiaisravdvaeivrnrfipdiqieni
dicteeiignegtatnvsaieiqlrk

SCOPe Domain Coordinates for d3toea_:

Click to download the PDB-style file with coordinates for d3toea_.
(The format of our PDB-style files is described here.)

Timeline for d3toea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3toeb_