Lineage for d3tkga_ (3tkg A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1130029Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1130045Protein Human immunodeficiency virus type 1 protease [50632] (7 species)
  7. 1130094Species Human immunodeficiency virus type 1 (bh5 isolate) [TaxId:11682] [186950] (13 PDB entries)
  8. 1130103Domain d3tkga_: 3tkg A: [195508]
    automated match to d2aoda_
    complexed with cl, gol, roc

Details for d3tkga_

PDB Entry: 3tkg (more details), 1.36 Å

PDB Description: crystal structure of hiv model protease precursor/saquinavir complex
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3tkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkga_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bh5 isolate) [TaxId: 11682]}
sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d3tkga_:

Click to download the PDB-style file with coordinates for d3tkga_.
(The format of our PDB-style files is described here.)

Timeline for d3tkga_: