| Class b: All beta proteins [48724] (176 folds) |
| Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
| Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
| Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
| Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (432 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
| Domain d3tl9b_: 3tl9 B: [195506] automated match to d2aoda_ complexed with cl, gol, na, roc |
PDB Entry: 3tl9 (more details), 1.32 Å
SCOPe Domain Sequences for d3tl9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tl9b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
sfnfpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikv
rqydqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
Timeline for d3tl9b_: