SCOPe 2.08: Domain d3ubra_: 3ubr A:

Lineage for d3ubra_ (3ubr A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [195500] (2 PDB entries)

8. Domain d3ubra_: 3ubr A: [195502]
   automated match to d1gu6a_
   complexed with ca, hec

Details for d3ubra_

PDB Entry: 3ubr, 2.59 Å

PDB Description: laue structure of shewanella oneidensis cytochrome-c nitrite reductase

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3ubra_:

Sequence; same for both SEQRES and ATOM records:

>d3ubra_ a.138.1.3 (A:) automated matches {Shewanella oneidensis [TaxId: 70863]}
sdkteprnevykdkfknqynswhdtakseelvdaleqdpnmvilwagyafakdykaprgh
myavtdvrntlrtgapknaedgplpmacwsckspdvprlieeqgedgyfkgkwakggpev
tntigcsdchekgspklrisrpyvdraldaigtpfskaskqdkesmvcaqchveyyfekk
edkkgfvkfpwdmgvtvdqmevyydgiefsdwthalsktpmlkaqhpeyetwkmgihgkn
nvscvdchmpkvtspegkkftdhkvgnpfdrfeetcatchsqtkeflvgvtnerkakvke
mklkaeeqlvkahfeaakawelgateaemkpiltdirhaqwrwdlaiashgvaahapeea
lrvlgtsvnkaadarvklaqllakkgltdpvaipdistkakaqavlgmdmekmnaekeaf
kkdmlpkwdaeakkreaty

Timeline for d3ubra_:

• d3ubra_ first appeared in SCOPe 2.02
  
• d3ubra_ appears in SCOPe 2.07