SCOP 1.69: Domain d1ppa__: 1ppa -

Lineage for d1ppa__ (1ppa -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Eastern cottonmouth snake (Agkistridon piscivorus) [48629] (2 PDB entries)

8. Domain d1ppa__: 1ppa - [19550]

Details for d1ppa__

PDB Entry: 1ppa, 2 Å

PDB Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution

SCOP Domain Sequences for d1ppa__:

Sequence; same for both SEQRES and ATOM records:

>d1ppa__ a.133.1.2 (-) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistridon piscivorus)}
svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
c

Timeline for d1ppa__:

• d1ppa__ first appeared (with stable ids) in SCOP 1.55
  
• d1ppa__ appears in SCOP 1.67
  
• d1ppa__ appears in SCOP 1.71
  
• d1ppa__ appears in the current release, SCOPe 2.08, called d1ppaa_