Lineage for d1ppa__ (1ppa -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361344Species Eastern cottonmouth snake (Agkistridon piscivorus) [48629] (2 PDB entries)
  8. 361347Domain d1ppa__: 1ppa - [19550]
    complexed with anl

Details for d1ppa__

PDB Entry: 1ppa (more details), 2 Å

PDB Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution

SCOP Domain Sequences for d1ppa__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppa__ a.133.1.2 (-) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistridon piscivorus)}
svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
c

SCOP Domain Coordinates for d1ppa__:

Click to download the PDB-style file with coordinates for d1ppa__.
(The format of our PDB-style files is described here.)

Timeline for d1ppa__: