Lineage for d1ppa__ (1ppa -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Eastern cottonmouth snake (Agkistridon piscivorus) [48629] (2 PDB entries) 
Domain d1ppa__: 1ppa - [19550]
Details for d1ppa__
PDB Entry: 1ppa (more details), 2 Å
PDB Description: the crystal structure of a lysine 49 phospholipase a2 from the venom of the cottonmouth snake at 2.0 angstroms resolution
SCOP Domain Sequences for d1ppa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ppa__ a.133.1.2 (-) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistridon piscivorus)}
svlelgkmilqetgknaitsygsygcncgwghrgqpkdatdrccfvhkccykkltdcnhk
tdrysyswknkaiiceeknpclkemcecdkavaiclrenldtynkkykayfklkckkpdt
c
SCOP Domain Coordinates for d1ppa__:
Click to download the PDB-style file with coordinates for d1ppa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ppa__:
- d1ppa__ appears in SCOP 1.57
- d1ppa__ appears in the current release, SCOPe 2.08, called d1ppaa_
View in 3D