Lineage for d3ub5p_ (3ub5 P:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1922390Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1922391Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 1922392Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 1922393Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 1922407Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries)
  8. 1922409Domain d3ub5p_: 3ub5 P: [195498]
    Other proteins in same PDB: d3ub5a1, d3ub5a2
    automated match to d1pnea_
    complexed with atp, ca, cl, gol

Details for d3ub5p_

PDB Entry: 3ub5 (more details), 2.2 Å

PDB Description: Profilin:actin with a wide open nucleotide cleft
PDB Compounds: (P:) Profilin-1

SCOPe Domain Sequences for d3ub5p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ub5p_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

SCOPe Domain Coordinates for d3ub5p_:

Click to download the PDB-style file with coordinates for d3ub5p_.
(The format of our PDB-style files is described here.)

Timeline for d3ub5p_: