SCOPe 2.08: Domain d3v64a1: 3v64 A:1759-1948

Lineage for d3v64a1 (3v64 A:1759-1948)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.4: Laminin G-like module [49944] (7 proteins)

6. Protein automated matches [190380] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries)

8. Domain d3v64a1: 3v64 A:1759-1948 [195490]
   Other proteins in same PDB: d3v64a2
   automated match to d1pz9b_
   complexed with ca, nag, po4

Details for d3v64a1

PDB Entry: 3v64, 2.85 Å

PDB Description: crystal structure of agrin and lrp4

PDB Compounds: (A:) Agrin

SCOPe Domain Sequences for d3v64a1:

Sequence; same for both SEQRES and ATOM records:

>d3v64a1 b.29.1.4 (A:1759-1948) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
letlafdgrtyieylnavieseltneipaekalqsnhfelslrteatqglvlwigkaaer
adymalaivdghlqlsydlgsqpvvlrstvkvntnrwlrirahrehregslqvgneapvt
gssplgatqldtdgalwlgglqklpvgqalpkaygtgfvgclrdvvvghrqlhlledavt
kpelrpcptp

Timeline for d3v64a1:

• d3v64a1 first appeared in SCOPe 2.02, called d3v64a_
  
• d3v64a1 appears in SCOPe 2.07