![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
![]() | Protein automated matches [190380] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [189379] (3 PDB entries) |
![]() | Domain d3v64b_: 3v64 B: [195489] Other proteins in same PDB: d3v64a2 automated match to d1pz9b_ complexed with ca, nag, po4 |
PDB Entry: 3v64 (more details), 2.85 Å
SCOPe Domain Sequences for d3v64b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v64b_ b.29.1.4 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} letlafdgrtyieylnavieseltneipaekalqsnhfelslrteatqglvlwigkaaer adymalaivdghlqlsydlgsqpvvlrstvkvntnrwlrirahrehregslqvgneapvt gssplgatqldtdgalwlgglqklpvgqalpkaygtgfvgclrdvvvghrqlhlledavt kpelrpcptp
Timeline for d3v64b_: