SCOPe 2.06: Domain d3zqxa1: 3zqx A:1-145

Lineage for d3zqxa1 (3zqx A:1-145)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (9 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)

8. Domain d3zqxa1: 3zqx A:1-145 [195484]
   Other proteins in same PDB: d3zqxa2
   automated match to d3zuca_
   complexed with ca

Details for d3zqxa1

PDB Entry: 3zqx, 1.04 Å

PDB Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum

PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d3zqxa1:

Sequence; same for both SEQRES and ATOM records:

>d3zqxa1 b.2.2.0 (A:1-145) automated matches {Clostridium thermocellum [TaxId: 1515]}
dvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytpi
gsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadwsfhdqsndysfdpti
kafqdygkvtlykngelvwgtppgg

Timeline for d3zqxa1:

• d3zqxa1 first appeared in SCOPe 2.02, called d3zqxa_
  
• d3zqxa1 was called d3zqxa_ in SCOPe 2.05
  
• d3zqxa1 appears in SCOPe 2.07
  
• d3zqxa1 appears in the current release, SCOPe 2.08