SCOPe 2.05: Domain d3zqxa_: 3zqx A:

Lineage for d3zqxa_ (3zqx A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (7 PDB entries)

8. Domain d3zqxa_: 3zqx A: [195484]
   automated match to d3zuca_
   complexed with ca

Details for d3zqxa_

PDB Entry: 3zqx, 1.04 Å

PDB Description: Carbohydrate-binding module CBM3b from the cellulosomal cellobiohydrolase 9A from Clostridium thermocellum

PDB Compounds: (A:) Cellulose 1,4-beta-cellobiosidase

SCOPe Domain Sequences for d3zqxa_:

Sequence; same for both SEQRES and ATOM records:

>d3zqxa_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
mdvkvqylcentqtstqeikgkfnivntgnrdyslkdivlryyftkehnsqlqficyytp
igsgnlipsfggsgdehylqlefkdvklpaggqtgeiqfviryadwsfhdqsndysfdpt
ikafqdygkvtlykngelvwgtppgg

Timeline for d3zqxa_:

• d3zqxa_ first appeared in SCOPe 2.02
  
• d3zqxa_ appears in SCOPe 2.04
  
• d3zqxa_ is called d3zqxa1 in SCOPe 2.06
  
• d3zqxa_ appears in the current release, SCOPe 2.08, called d3zqxa1