Lineage for d1vapa_ (1vap A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346133Species Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId:8716] [48629] (2 PDB entries)
  8. 2346134Domain d1vapa_: 1vap A: [19548]

Details for d1vapa_

PDB Entry: 1vap (more details), 1.6 Å

PDB Description: the monomeric asp49 secretory phospholipase a2 from the venom of agkistridon piscivorus piscivorus
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1vapa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vapa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]}
nlfqfeklikkmtgksgmlwysaygcycgwggqgrpkdatdrccfvhdccygkvtgcnpk
mdiytysvdngnivcggtnpckkqicecdraaaicfrdnlktydsktywkypkknckees
epc

SCOPe Domain Coordinates for d1vapa_:

Click to download the PDB-style file with coordinates for d1vapa_.
(The format of our PDB-style files is described here.)

Timeline for d1vapa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vapb_