Lineage for d3c32b_ (3c32 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880645Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (78 PDB entries)
  8. 1880687Domain d3c32b_: 3c32 B: [195479]
    automated match to d1ycjb_
    complexed with cl, gol, kai, na

Details for d3c32b_

PDB Entry: 3c32 (more details), 1.72 Å

PDB Description: crystal structure of glur5 ligand-binding core in complex with sodium at 1.72 angstrom resolution
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3c32b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c32b_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrgngcp

SCOPe Domain Coordinates for d3c32b_:

Click to download the PDB-style file with coordinates for d3c32b_.
(The format of our PDB-style files is described here.)

Timeline for d3c32b_: