SCOPe 2.05: Domain d4dijb_: 4dij B:

Lineage for d4dijb_ (4dij B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
   core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
   duplication: consists of two structural repeats

4. Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families)
   binds to the transactivation domain of human p53

5. Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
   Pfam PF02201

6. Protein MDM2 [47594] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47596] (46 PDB entries)

8. Domain d4dijb_: 4dij B: [195472]
   automated match to d3jzra_
   complexed with blf

Details for d4dijb_

PDB Entry: 4dij, 1.9 Å

PDB Description: the central valine concept provides an entry in a new class of non peptide inhibitors of the p53-mdm2 interaction

PDB Compounds: (B:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4dijb_:

Sequence; same for both SEQRES and ATOM records:

>d4dijb_ a.42.1.1 (B:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
qipaseqetlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
sndllgdlfgvpsfsvkehrkiytmiyrnlvvv

Timeline for d4dijb_:

• d4dijb_ first appeared in SCOPe 2.02
  
• d4dijb_ appears in SCOPe 2.04
  
• d4dijb_ appears in SCOPe 2.06
  
• d4dijb_ appears in the current release, SCOPe 2.08