Lineage for d4djnb_ (4djn B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2316569Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2316867Protein automated matches [190435] (12 species)
    not a true protein
  7. 2316939Species Human (Homo sapiens) [TaxId:9606] [193902] (7 PDB entries)
  8. 2316946Domain d4djnb_: 4djn B: [195470]
    automated match to d2uw2a1
    complexed with edo, so4

Details for d4djnb_

PDB Entry: 4djn (more details), 2.2 Å

PDB Description: crystal structure of a ribonucleotide reductase m2 b (rnrr2) from homo sapiens at 2.20 a resolution
PDB Compounds: (B:) ribonucleoside-diphosphate reductase subunit m2 b

SCOPe Domain Sequences for d4djnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4djnb_ a.25.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iksneepllrkssrrfvifpiqypdiwkmykqaqasfwtaeevdlskdlphwnklkadek
yfishilaffaasdgivnenlverfsqevqvpearcfygfqilienvhsemysllidtyi
rdpkkreflfnaietmpyvkkkadwalrwiadrkstfgervvafaavegvffsgsfaaif
wlkkrglmpgltfsnelisrdeglhcdfaclmfqylvnkpseervreiivdavkieqefl
tealpvgligmncilmkqyiefvadrllvelgfskvfqaenpfdfme

SCOPe Domain Coordinates for d4djnb_:

Click to download the PDB-style file with coordinates for d4djnb_.
(The format of our PDB-style files is described here.)

Timeline for d4djnb_: