Lineage for d1a2ah_ (1a2a H:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51243Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 51244Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 51249Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 51319Protein Snake phospholipase A2 [48624] (12 species)
  7. 51323Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (6 PDB entries)
  8. 51345Domain d1a2ah_: 1a2a H: [19547]

Details for d1a2ah_

PDB Entry: 1a2a (more details), 2.8 Å

PDB Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1a2ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ah_ a.133.1.2 (H:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOP Domain Coordinates for d1a2ah_:

Click to download the PDB-style file with coordinates for d1a2ah_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ah_: