Lineage for d4e6sa_ (4e6s A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086307Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1086448Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1086480Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1086481Protein automated matches [191156] (2 species)
    not a true protein
  7. 1086486Species Mus musculus [TaxId:10090] [195468] (1 PDB entry)
  8. 1086487Domain d4e6sa_: 4e6s A: [195469]
    automated match to d2fi2a1

Details for d4e6sa_

PDB Entry: 4e6s (more details), 1.85 Å

PDB Description: Crystal structure of the SCAN domain from mouse Zfp206
PDB Compounds: (A:) Zinc finger and SCAN domain-containing protein 10

SCOPe Domain Sequences for d4e6sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e6sa_ a.28.3.0 (A:) automated matches {Mus musculus [TaxId: 10090]}
grprpevahqlfrcfqyqedmgpraslgrlrelcnhwlrpalhtkkqilellvleqflsv
lpphvlsrlhgaplrdgeevaqleg

SCOPe Domain Coordinates for d4e6sa_:

Click to download the PDB-style file with coordinates for d4e6sa_.
(The format of our PDB-style files is described here.)

Timeline for d4e6sa_: