![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
![]() | Protein automated matches [191156] (12 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195468] (1 PDB entry) |
![]() | Domain d4e6sa_: 4e6s A: [195469] automated match to d2fi2a1 |
PDB Entry: 4e6s (more details), 1.85 Å
SCOPe Domain Sequences for d4e6sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e6sa_ a.28.3.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} grprpevahqlfrcfqyqedmgpraslgrlrelcnhwlrpalhtkkqilellvleqflsv lpphvlsrlhgaplrdgeevaqleg
Timeline for d4e6sa_: