SCOPe 2.05: Domain d4eqgb_: 4eqg B:

Lineage for d4eqgb_ (4eqg B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [224916] (3 PDB entries)

8. Domain d4eqgb_: 4eqg B: [195462]
   automated match to d3tw2a_
   complexed with a5a, epe

Details for d4eqgb_

PDB Entry: 4eqg, 1.52 Å

PDB Description: crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from human complexed with ala-ams

PDB Compounds: (B:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d4eqgb_:

Sequence; same for both SEQRES and ATOM records:

>d4eqgb_ d.13.1.1 (B:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]}
rpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaeddde
sllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

Timeline for d4eqgb_:

• d4eqgb_ first appeared in SCOPe 2.02
  
• d4eqgb_ appears in SCOPe 2.04
  
• d4eqgb_ appears in SCOPe 2.06
  
• d4eqgb_ appears in the current release, SCOPe 2.08