SCOPe 2.08: Domain d4erha_: 4erh A:

Lineage for d4erha_ (4erh A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Salmonella enterica [TaxId:588858] [195456] (1 PDB entry)

8. Domain d4erha_: 4erh A: [195458]
   automated match to d1r1ma_
   complexed with gol, so4

Details for d4erha_

PDB Entry: 4erh, 2.52 Å

PDB Description: the crystal structure of ompa domain of ompa from salmonella enterica subsp. enterica serovar typhimurium str. 14028s

PDB Compounds: (A:) outer membrane protein a

SCOPe Domain Sequences for d4erha_:

Sequence; same for both SEQRES and ATOM records:

>d4erha_ d.79.7.0 (A:) automated matches {Salmonella enterica [TaxId: 588858]}
evqtkhftlksdvlfnfnkstlkpegqqaldqlysqlsnldpkdgsvvvlgftdrigsda
ynqglsekraqsvvdyliskgipsdkisargmgesnpvtgntcdnvkpraalidclapdr
rveievkgv

Timeline for d4erha_:

• d4erha_ first appeared in SCOPe 2.02
  
• d4erha_ appears in SCOPe 2.07