SCOPe 2.02: Domain d3qx1a_: 3qx1 A:

Lineage for d3qx1a_ (3qx1 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.2: UBX domain [54250] (6 proteins)
   Pfam PF00789

6. Protein automated matches [191298] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189969] (4 PDB entries)

8. Domain d3qx1a_: 3qx1 A: [195453]
   automated match to d1h8ca_
   complexed with so4

Details for d3qx1a_

PDB Entry: 3qx1, 1.6 Å

PDB Description: Crystal structure of FAF1 UBX domain

PDB Compounds: (A:) fas-associated factor 1

SCOPe Domain Sequences for d3qx1a_:

Sequence; same for both SEQRES and ATOM records:

>d3qx1a_ d.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp
nksllevklfpqetlfleake

Timeline for d3qx1a_:

• d3qx1a_ is new in SCOPe 2.02-stable
  
• d3qx1a_ appears in SCOPe 2.03
  
• d3qx1a_ appears in the current release, SCOPe 2.08, called d3qx1a1