SCOPe 2.07: Domain d3qx1b1: 3qx1 B:571-649

Lineage for d3qx1b1 (3qx1 B:571-649)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.2: UBX domain [54250] (6 proteins)
   Pfam PF00789

6. Protein automated matches [191298] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)

8. Domain d3qx1b1: 3qx1 B:571-649 [195452]
   Other proteins in same PDB: d3qx1a2, d3qx1b2
   automated match to d1h8ca_
   complexed with so4

Details for d3qx1b1

PDB Entry: 3qx1, 1.6 Å

PDB Description: Crystal structure of FAF1 UBX domain

PDB Compounds: (B:) fas-associated factor 1

SCOPe Domain Sequences for d3qx1b1:

Sequence; same for both SEQRES and ATOM records:

>d3qx1b1 d.15.1.2 (B:571-649) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
ksllevklfpqetlfleak

Timeline for d3qx1b1:

• d3qx1b1 first appeared in SCOPe 2.02, called d3qx1b_
  
• d3qx1b1 appears in SCOPe 2.06
  
• d3qx1b1 appears in the current release, SCOPe 2.08