Lineage for d2vn1b_ (2vn1 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408627Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 1408628Protein automated matches [191162] (11 species)
    not a true protein
  7. 1408659Species Plasmodium falciparum [TaxId:36329] [195450] (2 PDB entries)
  8. 1408661Domain d2vn1b_: 2vn1 B: [195451]
    automated match to d3ni6a_
    complexed with fk5

Details for d2vn1b_

PDB Entry: 2vn1 (more details), 2.35 Å

PDB Description: crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506
PDB Compounds: (B:) 70 kDa peptidylprolyl isomerase

SCOPe Domain Sequences for d2vn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vn1b_ d.26.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
efekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpf
kfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsf
rele

SCOPe Domain Coordinates for d2vn1b_:

Click to download the PDB-style file with coordinates for d2vn1b_.
(The format of our PDB-style files is described here.)

Timeline for d2vn1b_: