SCOPe 2.08: Domain d2vn1b1: 2vn1 B:6-127

Lineage for d2vn1b1 (2vn1 B:6-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [195450] (5 PDB entries)

8. Domain d2vn1b1: 2vn1 B:6-127 [195451]
   Other proteins in same PDB: d2vn1a2, d2vn1b2
   automated match to d3ni6a_
   complexed with fk5

Details for d2vn1b1

PDB Entry: 2vn1, 2.35 Å

PDB Description: crystal structure of the fk506-binding domain of plasmodium falciparum fkbp35 in complex with fk506

PDB Compounds: (B:) 70 kDa peptidylprolyl isomerase

SCOPe Domain Sequences for d2vn1b1:

Sequence; same for both SEQRES and ATOM records:

>d2vn1b1 d.26.1.0 (B:6-127) automated matches {Plasmodium falciparum [TaxId: 36329]}
efekveltadggviktilkkgdegeenipkkgnevtvhyvgklestgkvfdssfdrnvpf
kfhleqgevikgwdicvssmrknekclvriesmygygdegcgesipgnsvllfeiellsf
re

Timeline for d2vn1b1:

• d2vn1b1 first appeared in SCOPe 2.02, called d2vn1b_
  
• d2vn1b1 appears in SCOPe 2.07