SCOPe 2.07: Domain d3rjnb_: 3rjn B:

Lineage for d3rjnb_ (3rjn B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 protein domains)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (84 PDB entries)

8. Domain d3rjnb_: 3rjn B: [195446]
   automated match to d2v1fa_
   complexed with he5, so4; mutant

Details for d3rjnb_

PDB Entry: 3rjn, 1.9 Å

PDB Description: Horse heart myoglobin: D44K/D60K mutant with zinc (II) -deuteroporphyrin dimethyl ester

PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d3rjnb_:

Sequence; same for both SEQRES and ATOM records:

>d3rjnb_ a.1.1.2 (B:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d3rjnb_:

• d3rjnb_ first appeared in SCOPe 2.02
  
• d3rjnb_ appears in SCOPe 2.06