Lineage for d3rjnb_ (3rjn B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687850Protein Myoglobin [46469] (11 species)
  7. 2687855Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)
  8. 2687908Domain d3rjnb_: 3rjn B: [195446]
    automated match to d2v1fa_
    complexed with he5, so4; mutant

Details for d3rjnb_

PDB Entry: 3rjn (more details), 1.9 Å

PDB Description: Horse heart myoglobin: D44K/D60K mutant with zinc (II) -deuteroporphyrin dimethyl ester
PDB Compounds: (B:) Myoglobin

SCOPe Domain Sequences for d3rjnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjnb_ a.1.1.2 (B:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfkkfkhlkteaemkasek
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d3rjnb_:

Click to download the PDB-style file with coordinates for d3rjnb_.
(The format of our PDB-style files is described here.)

Timeline for d3rjnb_: