Lineage for d3rkqa1 (3rkq A:138-194)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691985Domain d3rkqa1: 3rkq A:138-194 [195443]
    Other proteins in same PDB: d3rkqa2, d3rkqb2
    automated match to d1ftta_
    protein/DNA complex; complexed with mg

Details for d3rkqa1

PDB Entry: 3rkq (more details), 1.7 Å

PDB Description: NKX2.5 Homeodomain dimer bound to ANF-242 DNA
PDB Compounds: (A:) Homeobox protein Nkx-2.5

SCOPe Domain Sequences for d3rkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rkqa1 a.4.1.1 (A:138-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrkprvlfsqaqvyelerrfkqqrylsaperdqlasvlkltstqvkiwfqnrryksk

SCOPe Domain Coordinates for d3rkqa1:

Click to download the PDB-style file with coordinates for d3rkqa1.
(The format of our PDB-style files is described here.)

Timeline for d3rkqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rkqa2