Lineage for d3rs1b_ (3rs1 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002677Domain d3rs1b_: 3rs1 B: [195442]
    automated match to d3hupa_
    complexed with cl

Details for d3rs1b_

PDB Entry: 3rs1 (more details), 1.94 Å

PDB Description: Mouse C-type lectin-related protein Clrg
PDB Compounds: (B:) C-type lectin domain family 2 member I

SCOPe Domain Sequences for d3rs1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rs1b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg
dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk
ln

SCOPe Domain Coordinates for d3rs1b_:

Click to download the PDB-style file with coordinates for d3rs1b_.
(The format of our PDB-style files is described here.)

Timeline for d3rs1b_: