Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries) |
Domain d3rs1b_: 3rs1 B: [195442] automated match to d3hupa_ complexed with cl |
PDB Entry: 3rs1 (more details), 1.94 Å
SCOPe Domain Sequences for d3rs1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rs1b_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mnktyaacsknwtgvgnkcfyfsgyprnwtfaqafcmaqeaqlarfdneeeliflkrfkg dfdswiglhressehpwkwtnnteynnmnpilgvgryaylssdrisssrsyinrmwicsk ln
Timeline for d3rs1b_: