SCOPe 2.08: Domain d3rvna1: 3rvn A:1-129

Lineage for d3rvna1 (3rvn A:1-129)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries)

8. Domain d3rvna1: 3rvn A:1-129 [195440]
   Other proteins in same PDB: d3rvna2, d3rvnb2
   automated match to d1djma_
   complexed with bef, gol, mn, so4

Details for d3rvna1

PDB Entry: 3rvn, 2.25 Å

PDB Description: structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89y

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvna1:

Sequence; same for both SEQRES and ATOM records:

>d3rvna1 c.23.1.1 (A:1-129) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

Timeline for d3rvna1:

• d3rvna1 first appeared in SCOPe 2.02, called d3rvna_
  
• d3rvna1 appears in SCOPe 2.07