Lineage for d3rvna1 (3rvn A:1-129)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855710Protein automated matches [190177] (9 species)
    not a true protein
  7. 2855718Species Escherichia coli K-12 [TaxId:83333] [189043] (16 PDB entries)
  8. 2855743Domain d3rvna1: 3rvn A:1-129 [195440]
    Other proteins in same PDB: d3rvna2, d3rvnb2
    automated match to d1djma_
    complexed with bef, gol, mn, so4

Details for d3rvna1

PDB Entry: 3rvn (more details), 2.25 Å

PDB Description: structure of the chey-bef3 complex with substitutions at 59 and 89: n59d and e89y
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d3rvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rvna1 c.23.1.1 (A:1-129) automated matches {Escherichia coli K-12 [TaxId: 83333]}
madkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwdm
pnmdglellktiradgamsalpvlmvtayakkeniiaaaqagasgyvvkpftaatleekl
nkifeklgm

SCOPe Domain Coordinates for d3rvna1:

Click to download the PDB-style file with coordinates for d3rvna1.
(The format of our PDB-style files is described here.)

Timeline for d3rvna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rvna2