![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
![]() | Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
![]() | Protein automated matches [195426] (7 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [195437] (5 PDB entries) |
![]() | Domain d3sika_: 3sik A: [195439] automated match to d2o6pb1 complexed with hem |
PDB Entry: 3sik (more details), 2.15 Å
SCOPe Domain Sequences for d3sika_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sika_ b.1.28.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} atkladgkyniaftvwkgdkdessrmnryfespatltvkngkqyvsfkvkdstsiksfqv ekdgqfvettvlsenkkdntrvvefevadlskklngkvkinipiinynasydirfvfdgn sik
Timeline for d3sika_: