Lineage for d1a2ac_ (1a2a C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750360Protein Snake phospholipase A2 [48624] (36 species)
  7. 1750413Species Halys viper (Agkistrodon halys) [TaxId:8714] [48628] (9 PDB entries)
  8. 1750436Domain d1a2ac_: 1a2a C: [19542]
    complexed with cl

Details for d1a2ac_

PDB Entry: 1a2a (more details), 2.8 Å

PDB Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas
PDB Compounds: (C:) phospholipase a2

SCOPe Domain Sequences for d1a2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ac_ a.133.1.2 (C:) Snake phospholipase A2 {Halys viper (Agkistrodon halys) [TaxId: 8714]}
nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOPe Domain Coordinates for d1a2ac_:

Click to download the PDB-style file with coordinates for d1a2ac_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ac_: