Lineage for d1a2ac_ (1a2a C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449128Species Chinese water moccasin (Agkistrodon halys pallas), different isoforms [48628] (9 PDB entries)
  8. 449151Domain d1a2ac_: 1a2a C: [19542]

Details for d1a2ac_

PDB Entry: 1a2a (more details), 2.8 Å

PDB Description: agkistrotoxin, a phospholipase a2-type presynaptic neurotoxin from agkistrodon halys pallas

SCOP Domain Sequences for d1a2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ac_ a.133.1.2 (C:) Snake phospholipase A2 {Chinese water moccasin (Agkistrodon halys pallas), different isoforms}
nllqfnkmikeetgknaipfyafygcycggggngkpkdgtdrccfvhdccygrlvncntk
sdiysyslkegyitcgkgtnceeqicecdrvaaecfrrnldtynngymfyrdskctetse
ec

SCOP Domain Coordinates for d1a2ac_:

Click to download the PDB-style file with coordinates for d1a2ac_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ac_: