Lineage for d3stwa_ (3stw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902478Species Lycopersicon hirsutum [TaxId:283673] [195413] (6 PDB entries)
  8. 2902489Domain d3stwa_: 3stw A: [195415]
    automated match to d2wfla_
    complexed with 2td

Details for d3stwa_

PDB Entry: 3stw (more details), 2.31 Å

PDB Description: crystal structure of tomato methylketone synthase i complexed with 2- tridecanone
PDB Compounds: (A:) Methylketone synthase 1

SCOPe Domain Sequences for d3stwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stwa_ c.69.1.0 (A:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}
fvkkhfvlvhtafhgawcwykivalmrssghnvtaldlgasginpkqalqipnfsdylsp
lmefmaslpanekiilvghalgglaiskametfpekisvavflsglmpgpnidattvctk
agsavlgqldncvtyengptnppttliagpkflatnvyhlspiedlalatalvrplylyl
aediskevvlsskrygsvkrvfivatendalkkeflklmieknppdevkeiegsdhvtmm
skpqqlfttllsiankyk

SCOPe Domain Coordinates for d3stwa_:

Click to download the PDB-style file with coordinates for d3stwa_.
(The format of our PDB-style files is described here.)

Timeline for d3stwa_: