SCOPe 2.08: Domain d3typb1: 3typ B:1-152

Lineage for d3typb1 (3typ B:1-152)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
   duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it

4. Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families)

5. Family d.63.1.2: CYTH domain [118007] (5 proteins)
   Pfam PF01928

6. Protein automated matches [190597] (3 species)
   not a true protein

7. Species Nitrosomonas europaea [TaxId:915] [195410] (1 PDB entry)

8. Domain d3typb1: 3typ B:1-152 [195411]
   Other proteins in same PDB: d3typa2, d3typb2, d3typb3
   automated match to d2fbla1
   complexed with edo, na

Details for d3typb1

PDB Entry: 3typ, 1.9 Å

PDB Description: The crystal structure of the inorganic triphosphatase NE1496

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d3typb1:

Sequence, based on SEQRES records:

>d3typb1 d.63.1.2 (B:1-152) automated matches {Nitrosomonas europaea [TaxId: 915]}
mvteierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlksegglsrq
eyeiqidvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflse
daaqafipppwfgeevtedkryknkalalsip

Sequence, based on observed residues (ATOM records):

>d3typb1 d.63.1.2 (B:1-152) automated matches {Nitrosomonas europaea [TaxId: 915]}
mvteierkflvatfpdgelhavplrqgylttptdsielrlrqqgteyfmtlkseqeyeiq
idvtqfemlwpategrrvektrysgklpdgqlfeldvfaghlsplmlveveflsedaaqa
fipppwfgeevtedkryknkalalsip

Timeline for d3typb1:

• d3typb1 first appeared in SCOPe 2.02, called d3typb_
  
• d3typb1 appears in SCOPe 2.07