Lineage for d3v8wb_ (3v8w B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
consists of two alpha+beta domains, C-terminal domain is mostly alpha helicalSuperfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) 
shares functional and structural similarities with the ATP-grasp fold and PIPK
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
members organized in the groups and subfamiles specified by the comments
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinaseSpecies Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
Uniprot Q08881 357-619
Domain d3v8wb_: 3v8w B: [195399]
automated match to d1sm2a_
complexed with 0g2, so4
Details for d3v8wb_
PDB Entry: 3v8w (more details), 2.27 Å
PDB Description: crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 469
PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSKSCOPe Domain Sequences for d3v8wb_:
Sequence, based on SEQRES records: (download)
>d3v8wb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaesg
Sequence, based on observed residues (ATOM records): (download)
>d3v8wb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgglvhlgywlnkdkvaiktirmseedfieeaevmmklshpklv
qlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvi
hrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegki
pyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiae
sg
SCOPe Domain Coordinates for d3v8wb_:
Click to download the PDB-style file with coordinates for d3v8wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3v8wb_:
- d3v8wb_ first appeared in SCOPe 2.02
- d3v8wb_ appears in SCOPe 2.04
- d3v8wb_ is called d3v8wb1 in SCOPe 2.06
- d3v8wb_ appears in the current release, SCOPe 2.08, called d3v8wb1
View in 3D
