Lineage for d3v8wb_ (3v8w B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931430Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1931431Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
    Uniprot Q08881 357-619
  8. 1931466Domain d3v8wb_: 3v8w B: [195399]
    automated match to d1sm2a_
    complexed with 0g2, so4

Details for d3v8wb_

PDB Entry: 3v8w (more details), 2.27 Å

PDB Description: crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 469
PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3v8wb_:

Sequence, based on SEQRES records: (download)

>d3v8wb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records): (download)

>d3v8wb_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgglvhlgywlnkdkvaiktirmseedfieeaevmmklshpklv
qlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvi
hrdlaarnclvgenqvikvsdfgpvkwaspevfsfsryssksdvwsfgvlmwevfsegki
pyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiae
sg

SCOPe Domain Coordinates for d3v8wb_:

Click to download the PDB-style file with coordinates for d3v8wb_.
(The format of our PDB-style files is described here.)

Timeline for d3v8wb_: